Bundespatentgericht:
Beschluss vom 14. April 2011
Aktenzeichen: 14 W (pat) 8/06

Tenor

Auf die Beschwerde der Patentinhaberin wird der angefochtene Beschluss aufgehoben und das Patent BPatG 152 mit den Patentansprüchen 1 bis 16 vom 28. Oktober 2005, den Beschreibungsseiten 2, 3 und 6 bis 23 gemäß Patentschrift, den Beschreibungsseiten 4 und 5 vom 7. April 2011 sowieeinem Blatt Zeichnung gemäß Patentschriftbeschränkt aufrechterhalten.

Gründe

I.

Die Patentabteilung 41 des Deutschen Patentund Markenamtes hat nach Prüfung des Einspruchs durch Beschluss vom 9. August 2005 das am 19. April 1991 angemeldete und mit der Bezeichnung

"Synthetische Core-Peptide zur Bestimmung von HCV-Antikörpern und HCV-Antigenen, Mittel dazu und ihre Verwendung in diesen Nachweis-Verfahren"

erteilte Patent gemäß § 61 Absatz 1 Satz 1 PatG widerrufen.

Der Widerruf des Patents wurde damit begründet, dass die Peptide des erteilten Patentanspruchs 1 gegenüber der nachveröffentlichten Druckschrift (D2) EP 0 471 356 A1 nicht neu seien.

Gegen diesen Beschluss hat die Patentinhaberin Beschwerde eingelegt und mit Schriftsatz vom 28. Oktober 2005 geänderte Patentansprüche 1 bis 16 eingereicht. Der neue Patentanspruch 1 lautet wie folgt:

"Peptide, die spezifisch mit Antikörpern gegen das HCV reagieren, dadurch gekennzeichnet, dass sie mindestens einer der folgenden Aminosäuresequenzen entsprechen:

1 30 MSTNPKPQRKTKRNTNRRPQDVKFPGGGQI SP 10 8 26 QRKTKRNTNRRPQDVKFPG SP 23 10 26 KTKRNTNRRPQDVKFPG SP 30 12 26 KRNTNRRPQDVKFPG SP 30 D 14 26 NTNRRPQDVKFPG SP 30 C 16 26 NRRPQDVKFPG SP 30 B 18 26 RPQDVKFPG SP 30 A 8 24 QRKTKRNTNRRPQDVKF SP 31 8 22 QRKTKRNTNRRPQDV SP 32."

Zur Begründung ihrer Beschwerde hat die Patentinhaberin schriftsätzlich im Wesentlichen vorgetragen, dass die nunmehr beanspruchten Peptide neu seien, da in keinem der zitierten Dokumente (D1) WO 90/11089 A1, (D2) EP 0 471 356 A1 und (D3) EP 0 489 968 A1 ein Peptid mit den im geltenden Patentanspruch 1 genannten Aminosäuresequenzen offenbart werde. Die beanspruchten Peptide beruhten im Hinblick auf die Druckschrift D1 zudem auf einer erfinderischen Tätigkeit, da diese Entgegenhaltung keine Lehre enthalte, wie Peptide mit HCV-Epitopen zuverlässig identifiziert werden könnten, und damit auch die patentgemäßen Peptide, die für immunchemische HCV-Tests geeignet seien, nicht nahelegen könne. Die Lehre des geltenden Patentanspruchs 16 sei zudem so deutlich und vollständig offenbart, dass ein Fachmann sie ausführen könne, da der Fachmann für die darin gezeigten variablen Aminosäuren aufgrund seines allgemeinen Könnens und Wissens keine Sequenzen auswählen werde, die zu ungewollten Kreuzreaktivitäten mit anderen Virus-Sequenzen führten.

Die Patentinhaberin beantragt, den angefochtenen Beschluss aufzuheben und das Patent mit den im Beschlusstenor aufgeführten Unterlagen beschränkt aufrechtzuerhalten.

Die Einsprechende hat mit Schriftsatz vom 17. Juli 2001 ihren Einspruch zurückgenommen und ist daher am Verfahren nicht mehr beteiligt.

Wegen weiterer Einzelheiten insbesondere dem Wortlaut der geltenden Patentansprüche 1 bis 16 wird auf den Inhalt der Akten verwiesen.

II.

Die Beschwerde ist zulässig (PatG § 73). Sie ist unter Berücksichtigung des nunmehr vorliegenden Patentbegehrens auch begründet.

1. Die geltenden Patentansprüche 1 bis 16 sind zulässig.

Anspruch 1 geht inhaltlich auf den ursprünglichen Anspruch 3 der Erstunterlagen bzw. auf den erteilten Anspruch 2 zurück. Der geltende Anspruch 2 geht auf den ursprünglichen Anspruch 5 i. V. m. Seite 12, Zeile 1 bis 20 der Erstunterlagen bzw. den erteilten Anspruch 4 i. V. m. Seite 5, Zeilen 11 bis 21 der Patentschrift zurück. Die geltenden Ansprüche 3 bis 15 entsprechen den ursprünglichen Ansprüchen 7 bis 19 unter Berücksichtigung der Angaben auf Seite 8, Zeile 24 bis 29, Seite 14, Zeile 8 und 9 sowie Seite 16, Zeile 25 bis 34 der Erstunterlagen bzw. den erteilten Ansprüchen 5 bis 16 und 18. Der geltende Anspruch 16 geht auf den ursprünglichen Anspruch 20 der Erstunterlagen bzw. auf den erteilten Anspruch 19 zurück. Die Ansprüche sind auch sonst nicht zu beanstanden.

2. Bezüglich der Ausführbarkeit der im geltenden Patentanspruch 16 offenbarten technischen Lehre bestehen keine Bedenken. Die im Patentanspruch 16 genannten Peptide reagieren spezifisch mit Antikörpern die gegen das Hepatitis C Virus (kurz HCV) gerichtet sind und besitzen sowohl N-terminal als auch C-terminal von einer definierten HCV-spezifischen Sequenz eine variable Anzahl von 1 bis 40 nicht näher definierten Aminosäuren. Nach Ansicht der Einsprechenden eröffne diese Variabilität der Aminosäuresequenz die Möglichkeit HCV-spezifische Sequenzen mit Sequenzabschnitten aus anderen Viren in einem einzigen Peptid zu kombinieren, was jedoch dazu führe, dass mit derartigen Peptiden kein spezifischer HCV-Nachweis möglich sei und diese Peptide somit auch nicht geeignet seien die dem Streitpatent zugrunde liegende Aufgabenstellung zu lösen.

Dieser Einwand vermag nach Ansicht des Senats nicht durchzugreifen. Es mag zwar zutreffend sein, dass der Patentanspruch 16 aufgrund der darin genannten variablen Aminosäuresequenz auch solche Peptide mit umfasst, die nicht spezifisch mit Antikörpern gegen das Hepatitis C Virus reagieren. Dies steht der Ausführbarkeit der im geltenden Patentanspruch 16 offenbarten technischen Lehre allerdings nicht entgegen, da ein Patentanspruch neben tauglichen auch untaugliche Varianten umfassen kann, sofern der Fachmann unter Einsatz seines Fachwissens in der Lage ist, die einzelnen Varianten mit zumutbarem Aufwand zu unterscheiden (vgl. Schulte, PatG, 8. Auflage, § 34 Rdn. 361 und 363, Punkt b) ). Dies ist vorliegend der Fall. Denn Spezifitätsprüfungen von Peptiden, mit denen -wie im Streitpatent vorgesehen -ein spezieller Virustyp in Patientenproben nachgewiesen werden soll (vgl. geltender Patentanspruch 12), gehören zu den Routinetätigkeiten des Fachmanns, bei dem es sich um einen im Bereich der Biochemie tätigen Chemiker handelt, der sich mit der Identifizierung und Charakterisierung viraler Peptide befasst und mit der Entwicklung immunchemischer Nachweisverfahren vertraut ist. Zudem impliziert bereits die dem Streitpatent zugrunde liegende Aufgabenstellung die Vermeidung von Kreuzreaktivitäten, da die objektive Aufgabe darin zu sehen ist, die Empfindlichkeit von Verfahren zum spezifischen Nachweis des Hepatitis C Virus deutlich zu steigern und die Störanfälligkeit dieser Verfahren signifikant zu erniedrigen (vgl. Patentschrift, S. 3, Z. 15 bis 18), so dass der Fachmann für die variablen Sequenzabschnitte von vornherein keine Sequenzen in Betracht ziehen wird, die für ein anderes Virus als das Hepatitis C Virus spezifisch sind.

3. Die Peptide des geltenden Patentanspruchs 1 sind neu.

Keine der entgegengehaltenen Druckschriften offenbart Peptide mit den im geltenden Patentanspruch 1 genannten Aminosäuresequenzen.

In der WO 90/11089 A1 (= D1) werden neben der vollständigen Aminosäuresequenz für das Hepatitis C Virus auch Polypeptide beschrieben, die HCV-Epitope repräsentieren und mit denen sich in einer Probe enthaltene anti-HCV Antikörper nachweisen lassen (vgl. D1, S. 9, Z. 10 bis S. 11, Z. 4 und Anspruch 10 sowie S. 13, Z. 22 bis 37 i. V. m. Fig. 17). Vier dieser Peptide, die als AA1-AA25, AA1-AA10, AA5-AA20 und AA20-AA25 bezeichnet werden, stammen aus dem nahen N-terminalen Bereich des HCV-Polypeptids und besitzen folglich Aminosäuresequenzen, die sich abschnittsweise auch in den Aminosäuresequenzen der Peptide des geltenden Patentanspruchs 1 wiederfinden. Peptide mit Aminosäuresequenzen des geltenden Patentanspruchs 1 werden in der D1 jedoch weder genannt, noch wird darin auf derartige Peptide hingewiesen.

Auch die nachveröffentlichte Druckschrift EP 0 471 356 A1 (= D2) vermag die Neuheit der Peptide des geltenden Patentanspruchs 1 nicht in Frage zu stellen. In dieser Entgegenhaltung werden zwar Peptide beschrieben, die sich für den Nachweis von anti-HCV Antikörpern eignen und deren Aminosäuresequenz entweder den Aminosäuren 1 bis 20 des im geltenden Patentanspruch 1 als SP10 bezeichneten Peptids entspricht, oder die diesen Sequenzabschnitt enthält bzw. aus einem Teil dieser Sequenz besteht (vgl. D2, Zusammenfassung i. V. m. Anspruch 1). Da in der D2 allerdings außer den zuvor genannten 20 Aminosäuren keine weiteren Aminosäuresequenzen stofflich definiert werden, offenbart auch diese Entgegenhaltung keine Peptide mit den im geltenden Patentanspruch 1 angegebenen Aminosäuresequenzen.

Die ebenfalls nachveröffentlichte Entgegenhaltung EP 0 489 968 A1 (= D3) betrifft synthetisch hergestellte Antigene zum Nachweis von Antikörpern, die gegen das Hepatitis C Virus gerichtet sind (vgl. D3, Titel i. V. m. S. 3, Z. 5 bis 9 und 29 bis 36 i. V. m. Anspruch 22). Einige der Peptide stammen aus dem N-terminalen Bereich des HCV-Proteins, so dass auch sie teilweise Übereinstimmungen mit den Peptiden des geltenden Patentanspruchs 1 aufweisen. Aminosäuresequenzen wie im geltenden Patentanspruch 1 genannt, finden sich in der Druckschrift D3 allerdings nicht.

4. Die Peptide des geltenden Patentanspruchs 1 beruhen auch auf einer erfinderischen Tätigkeit.

Die Entgegenhaltungen D2 und D3 sind nachveröffentlicht und daher bei der Beurteilung der erfinderischen Tätigkeit nicht zu berücksichtigen.

Wie einleitend in der Streitpatentschrift ausgeführt wird, weisen die im Stand der Technik bekannten immunchemischen Verfahren, die zum Nachweis einer Hepatitis C Virus-Infektion verwendet werden, grundsätzlich das Problem auf, dass Proben dabei falsch positiv oder falsch negativ reagieren (vgl. Patentschrift, S. 2, Z. 56/57). Ausgehend davon ist die dem Streitpatent zugrunde liegende Aufgabe darin zu sehen, die Empfindlichkeit der bekannten immunchemischen Verfahren zu steigern und gleichzeitig unerwünschte falsch positive Reaktionen zu vermeiden (vgl. Patentschrift, S. 3, Z. 15 bis 18).

Eine vergleichbare Aufgabenstellung wie dem Streitpatent liegt auch der Druckschrift D1 zugrunde, die mit dem immunchemischen Nachweis und der Behandlung von HCV-Infektionen befasst ist (vgl. D1, S. 8, Z. 17 bis 19). Für die Bestimmung von anti-HCV Antikörpern in Patientenproben lehrt die D1 die Verwendung von synthetisch hergestellten Polypeptiden, die ein Epitop des Hepatitis C Virus enthalten (vgl. D1, S. 13, Z. 22 bis 27 i. V. m. Anspruch 9). Den Angaben der D1 zufolge finden sich Peptide mit dieser Eigenschaft in nahezu allen Bereichen der durch das HCV-Genom codierten Aminosäuresequenz, was durch eine Fülle an stofflich definierten Peptiden belegt wird (vgl. D1, S. 9, Z. 10 bis S. 11, Z. 4 und S. 38, Z. 15 bis S. 40, Z. 2 und Anspruch 10). Fünf von den genannten Peptiden werden als "sehr immunogen" erachtet und damit ins Blickfeld des Fachmanns gerückt (vgl. D1, S. 82/83, seitenübergreifender Absatz i. V. m. S. 84, Z. 4 bis 32). Da allerdings auch diese Peptide aus unterschiedlichen Bereichen der Aminosäuresequenz des Hepatitis C Virus stammen, liefern die in der D1 enthaltenen Informationen dem Fachmann keine Veranlassung, gezielt im N-terminalen Sequenzbereich nach weiteren Peptiden mit immundominanten Epitopen zu suchen, die spezifisch mit Antikörpern gegen HCV reagieren. Daran ändert auch die Tatsache nichts, dass einige der in der D1 genannten Peptide im N-terminalen Bereich des Proteins liegen und folglich Sequenzüberschneidungen mit den patentgemäßen Peptiden aufweisen, da es -wie bereits zuvor ausgeführt -in der D1 an Hinweisen dahingehend fehlt, dass die immunogenen Eigenschaften N-terminaler Peptide besonders ausgeprägt sind (vgl. D1, S. 9, Z. 18/19 bzgl. AA1-25, AA1-10, AA5-20 und AA20-25). Die Feststellung in der D1, wonach die für einen spezifischen HCV-Nachweis geeigneten Peptide nicht notwendigerweise mit einem Epitop übereinstimmen müssen bzw. auch nicht immunogene Sequenzen enthalten können, führt vom Gegenstand des Streitpatents vielmehr weg (vgl. D1, S. 38, Z. 20 bis 25).

Zudem besitzen die Peptide der D1 unterschiedlichste Längen, so dass die Lehre der D1 auch keine Peptide mit relativ kurzen Aminosäuresequenzen, wie sie im geltenden Patentanspruch 1 beschrieben werden, nahelegt. Der Fachmann wird daher nicht erwarten, dass kurze Peptide aus der aminoterminalen HCV-core-Region eine gesteigerte analytische Sensitivität besitzen, wie sie für die patentgemäßen Peptide nachgewiesen worden ist (vgl. Patentschrift, S. 9 , Z. 67 bis S. 23, Z. 3). Somit vermag dieses Dokument dem Fachmann keine Anregung dahingehend zu vermitteln, zur Lösung der dem Streitpatent zugrunde liegende Aufgabe Peptide mit den im Patentanspruch 1 genannten Aminosäuresequenzen zu verwenden und damit Peptide, die relativ kurz sind und aus dem N-terminalen Bereich der vom HCV-Genom codierten Aminosäuresequenz stammen.

Nach alledem ist der Gegenstand des geltenden Patentanspruchs 1 neu und beruht auch auf einer erfinderischen Tätigkeit, so dass dieser Anspruch Bestand hat.

5. Die nebengeordneten Patentansprüche 5 bis 7, 9, 10, 11 und 13 sind gerichtet auf DNA-Sequenzen, die für die patentgemäßen Peptide codieren (vgl. Patentanspruch 5), auf Antikörper, die zu den patentgemäßen Peptiden eine biospezifische Affinität haben (vgl. Patentanspruch 6), auf ein immunchemisches Verfahren zum Nachweis und/oder zur Bestimmung von HCV Antikörpern unter Verwendung der patentgemäßen Peptide (vgl. Patentanspruch 7), auf ein analytisches Verfahren zum Nachweis und/oder zur Bestimmung von HCV unter Verwendung einer Nukleinsäuresonde die zu einer der patentgemäßen DNA-Sequenzen komplementär ist (vgl. Patentanspruch 9), auf eine Vakzine, die mindestens ein patentgemäßes Peptid enthält (vgl. Patentanspruch 10), auf die Verwendung der patentgemäßen Peptide zur Erzeugung von Antikörpern in Säugetieren, insbesondere in Menschen (vgl. Patentanspruch 11), sowieauf die Verwendung von Antikörpern gegen die patentgemäßen Peptide in einem Verfahren zum Nachweis von HCV (vgl. Patentanspruch 13).

Da Peptide, hierfür codierende Nukleinsäuren und gegen diese Peptide gerichtete Antikörper aufgrund biochemischer Gesetzmäßigkeiten voneinander ableitbar sind, gelten bezüglich Neuheit und erfinderischer Tätigkeit für die Patentansprüche 5 bis 7, 9, 10,11 und 13 die vorstehend im Zusammenhang mit dem geltenden Patentanspruch 1 dargelegten Gesichtspunkte gleichermaßen, so dass diese Patentansprüche ebenfalls Bestand haben.

Das Gleiche gilt für die auf den Patentanspruch 1 rückbezogenen Patentansprüche 2 bis 4, 15 und 16, die auf den Patentanspruch 7 rückbezogenen Patentansprüche 8 und 12, sowie den auf den Patentanspruch 13 rückbezogenen Patentanspruch 14, die jeweils weitere, über platte Selbstverständlichkeiten hinausgehende Ausführungsformen betreffen.

Proksch-Ledig Schwarz-Angele Schuster Münzberg Fa






BPatG:
Beschluss v. 14.04.2011
Az: 14 W (pat) 8/06


Link zum Urteil:
https://www.admody.com/urteilsdatenbank/2ad90e9bd539/BPatG_Beschluss_vom_14-April-2011_Az_14-W-pat-8-06


Admody Rechtsanwälte Aktiengesellschaft

Bahnhofstraße 8
30159 Hannover
Deutschland


Tel.: +49 (0) 511 93 63 92 62
Fax: +49 (0) 511 64 69 36 80

service@admody.com
www.admody.com

Kontaktformular
Rückrufbitte



Für Recht.
Für geistiges Eigentum.
Für Schutz vor unlauterem Wettbewerb.
Für Unternehmen.
Für Sie.



Justitia

 


Bundesweite Dienstleistungen:

  • Beratung
  • Gerichtliche Vertretung
  • Außergerichtliche Vertretung
  • Gutachtenerstellung
  • Inkasso

Rechtsgebiete:

Gewerblicher Rechtsschutz

  • Markenrecht
  • Wettbewerbsrecht
  • Domainrecht
  • Lizenzrecht
  • Designrecht
  • Urheberrecht
  • Patentrecht
  • Lauterkeitsrecht
  • Namensrecht

Handels- & Gesellschaftsrecht

  • Kapitalgesellschaftsrecht
  • Personengesellschaftsrecht
  • Handelsgeschäftsrecht
  • Handelsstandsrecht
  • Internationales Kaufrecht
  • Internationales Gesellschaftsrecht
  • Konzernrecht
  • Umwandlungsrecht
  • Kartellrecht
  • Wirtschaftsrecht

IT-Recht

  • Vertragsrecht der Informationstechnologien
  • Recht des elektronischen Geschäftsverkehrs
  • Immaterialgüterrecht
  • Datenschutzrecht
  • Telekommunikationsrecht


Diese Seite teilen (soziale Medien):

LinkedIn+ Social Share Twitter Social Share Google+ Social Share Facebook Social Share








Admody Rechtsanwälte Aktiengesellschaft



Jetzt Kontakt aufnehmen:

Per Telefon: +49 (0) 511 93 63 92 62.

Per E-Mail: service@admody.com.

Zum Kontaktformular.





Admody Rechtsanwälte Aktiengesellschaft Stamp Logo




Hinweise zur Urteilsdatenbank:
Bitte beachten Sie, dass das in der Urteilsdatenbank veröffentlichte Urteil weder eine rechtliche noch tatsächliche Meinung der Admody Rechtsanwälte Aktiengesellschaft widerspiegelt. Es wird für den Inhalt keine Haftung übernommen, insbesondere kann die Lektüre eines Urteils keine Beratung im Einzelfall ersetzen. Bitte verlassen Sie sich nicht darauf, dass die Entscheidung in der hier angegeben Art und Weise Bestand hat oder von anderen Gerichten in ähnlicher Weise entschieden werden würde.
Lizenzhinweis: Enthält Daten von O‌p‌e‌n‌j‌u‌r, die unter der Open Database License (ODbL) veröffentlicht wurden.
Sollten Sie sich auf die angegebene Entscheidung verlassen wollen, so bitten Sie das angegebene Gericht um die Übersendung einer Kopie oder schlagen in zitierfähigen Werken diese Entscheidung nach.
Durch die Bereitstellung einer Entscheidung wird weder ein Mandatsverhähltnis begründet noch angebahnt.
Sollten Sie eine rechtliche Beratung und/oder eine Ersteinschätzung Ihres Falles wünschen, zögern Sie nicht, uns zu kontaktieren.


"Admody" und das Admody-Logo sind registrierte Marken von
Rechtsanwalt Sebastian Höhne, LL.M., LL.M.

18.01.2019 - 04:07 Uhr

Tag-Cloud:
Rechtsanwalt Domainrecht - Rechtsanwalt Internetrecht - Rechtsanwalt Markenrecht - Rechtsanwalt Medienrecht - Rechtsanwalt Wettbewerbsrecht - Mitbewerber abmahnen lassen


Aus der Urteilsdatenbank
LG Dortmund, Urteil vom 15. Januar 2016, Az.: 3 O 610/15 - BPatG, Beschluss vom 5. März 2009, Az.: 30 W (pat) 81/06 - OLG Hamm, Beschluss vom 16. Mai 2011, Az.: I-8 AktG 1/11 - BGH, Urteil vom 21. Juni 2001, Az.: I ZR 197/00 - BPatG, Beschluss vom 14. Juli 2009, Az.: 6 W (pat) 8/05 - BPatG, Beschluss vom 23. Juni 2006, Az.: 24 W (pat) 46/04 - BPatG, Beschluss vom 23. Mai 2001, Az.: 28 W (pat) 174/99 - BPatG, Beschluss vom 4. November 2010, Az.: 12 W (pat) 32/05 - LG Düsseldorf, Urteil vom 30. März 2010, Az.: 4a O 13/10 - BPatG, Beschluss vom 27. Juli 2005, Az.: 26 W (pat) 89/04